Czie Net | Manualidades, actividades y recursos para niños - Pequeocio

Manualidades, cuentos y canciones infantiles, recursos educativos ¡y miles de actividades para niños!..

21.03.2020 18:58:45

RELATED DOMAINS
czie.cn iconczie.cn czie.org iconczie.org czie.com iconczie.com czie.icu iconczie.icu czie.club iconczie.club czie.top iconczie.top czie.eu iconczie.eu czie.xyz iconczie.xyz czie.tk iconczie.tk czie.site iconczie.site czie.de iconczie.de pequeocio.com iconpequeocio.com pekegifs.com iconpekegifs.com programacionscratch.com iconprogramacionscratch.com manualidadesinfantiles.org iconmanualidadesinfantiles.org edufichas.com iconedufichas.com juegoideas.com iconjuegoideas.com papelisimo.es iconpapelisimo.es sesamo.com iconsesamo.com 100manualidades.com icon100manualidades.com waihieast.school.nz iconwaihieast.school.nz pequepolis.com iconpequepolis.com mamaymaestra.com iconmamaymaestra.com actividadesdeinfantilyprimaria.com iconactividadesdeinfantilyprimaria.com watchandcode.com iconwatchandcode.com quehacerconlosninos.es iconquehacerconlosninos.es actividadeseducativas.net iconactividadeseducativas.net manualidadesaraudales.com iconmanualidadesaraudales.com parapintarycolorear.com iconparapintarycolorear.com pipoclub.com iconpipoclub.com materialdeaprendizaje.com iconmaterialdeaprendizaje.com templatefor.net icontemplatefor.net lectivatum.com iconlectivatum.com matematicasiesoja.wordpress.com iconmatematicasiesoja.wordpress.com colorearya.com iconcolorearya.com elblogdehiara.org iconelblogdehiara.org colorear.net iconcolorear.net dietadelhuevo.com icondietadelhuevo.com dibujosonline.net icondibujosonline.net recursosparanovelasvisuales.blogspot.com iconrecursosparanovelasvisuales.blogspot.com conmasfuturo.com iconconmasfuturo.com vipkids.es iconvipkids.es pasittos.com iconpasittos.com erogazoo555.com iconerogazoo555.com choopan.com iconchoopan.com ideasymanualidades.com iconideasymanualidades.com arteparaninnos.blogspot.com iconarteparaninnos.blogspot.com carlitosbaby.com iconcarlitosbaby.com elbauldelconocimiento.wordpress.com iconelbauldelconocimiento.wordpress.com pequelandia.org iconpequelandia.org dibujosparaninos.blogspot.com icondibujosparaninos.blogspot.com grafiteca.info icongrafiteca.info recursosdidacticos.es iconrecursosdidacticos.es recursosparadj.blogspot.com iconrecursosparadj.blogspot.com conguitos.es iconconguitos.es rockbotic.com iconrockbotic.com conmishijos.com iconconmishijos.com masymasmanualidades.blogspot.com iconmasymasmanualidades.blogspot.com salticoz.blogspot.com iconsalticoz.blogspot.com cunavidad.com iconcunavidad.com experimentoscientificos.es iconexperimentoscientificos.es juegosdetiempolibre.org iconjuegosdetiempolibre.org argumentacionip.wordpress.com iconargumentacionip.wordpress.com labtak.mx iconlabtak.mx teambepro.com iconteambepro.com artistapirata.com iconartistapirata.com kadirblog.com iconkadirblog.com creativosonline.org iconcreativosonline.org hautatzen.net iconhautatzen.net microchile.cl iconmicrochile.cl croydon.com.co iconcroydon.com.co paylessdominicana.com iconpaylessdominicana.com penguinsbarcelona.com iconpenguinsbarcelona.com menudoscuadros.com iconmenudoscuadros.com boboli.es iconboboli.es pepeganga.com iconpepeganga.com unapizcadeeducacion.com iconunapizcadeeducacion.com actividadesfotocopiables.blogspot.com iconactividadesfotocopiables.blogspot.com zapatos.es iconzapatos.es juanregala.com.co iconjuanregala.com.co alumnoon.com iconalumnoon.com movieonmovil.com iconmovieonmovil.com vr-speed.com iconvr-speed.com babyradio.es iconbabyradio.es juegosinfantilespum.com iconjuegosinfantilespum.com waomoda.com iconwaomoda.com imaginarium.es iconimaginarium.es bibliopos.es iconbibliopos.es reseteomatematico.com iconreseteomatematico.com sphere-pro.com iconsphere-pro.com spherepress.com iconspherepress.com tecnosecundaria.es icontecnosecundaria.es chiquiwiki.com iconchiquiwiki.com patprimo.com iconpatprimo.com guiainfantil.com iconguiainfantil.com jav.ink iconjav.ink pc-solucion.es iconpc-solucion.es tiospanish.com icontiospanish.com classclassyesyes.com iconclassclassyesyes.com fichadeingles.blogspot.com iconfichadeingles.blogspot.com
REGISTAR AND REGISTRANT DATAS
Registrant Name: Registry Registrant ID: Not Available From Registry (has 4,450,480 domains)
Registrant Org:
Registrant Mail:
Registrant Country:
Registrar: Alibaba Cloud Computing (Beijing) Co., Ltd. (has 5,773,188 domains)
Status: ok
Created Date: 2003-04-28 06:31:59
Updated Date: 2017-04-14 07:55:24
Expires Date: 2020-04-28 06:31:59
KEYWORDS
NS DATAS
NAMESERVER IP COUNTRY FIND
dns2.hichina.com 106.11.211.64 China 251,506 domain finds
dns1.hichina.com 106.11.211.63 China 251,581 domain finds
WEBSITE CRAWL DATAS
Server Type:
Http Code: 200
X-UA-Compatible IE=edge
description Manualidades, cuentos y canciones infantiles, recursos educativos ¡y miles de actividades para niños!
robots index, follow
og:locale es_ES
og:type website
og:title Pequeocio - Actividades para niños
og:description %sitedesc%
og:url https://www.pequeocio.com/
og:site_name Pequeocio
fb:app_id 263716520886957
twitter:card summary_large_image
twitter:title Pequeocio - Actividades para niños
twitter:description %sitedesc%
twitter:site @pequeocio
google-site-verification 970rwopwl_5ZQefkEep3vCzsj6lGZb189Sp22LMXjYQ
p:domain_verify 970rwopwl_5ZQefkEep3vCzsj6lGZb189Sp22LMXjYQ
viewport width=device-width, initial-scale=1
msapplication-TileImage https://www.pequeocio.com/wp-content/uploads/2020/01/cropped-pequeocio-simbolo-270x270.png
DNS DATAS
HOST TYPE CLASS TTL EXTRA
czie.net A 599 IN ip : 58.216.233.102
czie.net NS 21407 IN target : dns2.hichina.com
czie.net NS 21407 IN target : dns1.hichina.com
czie.net SOA 599 IN minimum-ttl : 600
czie.net MX 599 IN target : mxbiz2.qq.com
czie.net MX 599 IN target : mxbiz1.qq.com
czie.net TXT 409 IN txt : v=spf1 include:spf.mail.qq.com ~all
HEADER DATAS
WHOIS DATAS
Domain Name: CZIE.NET
Registry Domain ID: 97281752_DOMAIN_NET-VRSN
Registrar WHOIS Server: grs-whois.hichina.com
Registrar URL: http://www.net.cn
Updated Date: 2017-04-14T04:55:24Z
Creation Date: 2003-04-28T03:31:59Z
Registry Expiry Date: 2020-04-28T03:31:59Z
Registrar: Alibaba Cloud Computing (Beijing) Co., Ltd.
Registrar IANA ID: 420
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +86.95187
Domain Status: ok https://icann.org/epp#ok
Name Server: DNS1.HICHINA.COM
Name Server: DNS2.HICHINA.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-11-30T20:45:08Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.